dict.md logo
Results for D in English, page 132
Dextrose/Sodium Chloride 3.3%-0.3% Intravenous Solution
DEXTROSE/SODIUM CHLORIDE 5%-0.11% Intravenous solution
DEXTROSE/SODIUM CHLORIDE 5%-0.2% Intravenous solution
DEXTROSE/SODIUM CHLORIDE 5%-0.225% Intravenous solution
DEXTROSE/SODIUM CHLORIDE 5%-0.3% Intravenous solution
DEXTROSE/SODIUM CHLORIDE 5%-0.33% Intravenous solution
DEXTROSE/SODIUM CHLORIDE 5%-0.45% Intravenous solution
DEXTROSE/SODIUM CHLORIDE 5%-0.9% Intravenous solution
DEXTROSE/SODIUM CHLORIDE/SODIUM LACTATE
DEXTROSE/TETRACAINE
DEXTROSE/THEOPHYLLINE
DEXTROSE/THEOPHYLLINE 5%-160 MG/100 ML Intravenous solution
DEXTROSE/THEOPHYLLINE 5%-200 MG/100 ML Intravenous solution
DEXTROSE/THEOPHYLLINE 5%-200 MG/50 ML Intravenous solution
DEXTROSE/THEOPHYLLINE 5%-320 MG/100 ML Intravenous solution
DEXTROSE/THEOPHYLLINE 5%-40 MG/100 ML Intravenous solution
DEXTROSE/THEOPHYLLINE 5%-400 MG/100 ML Intravenous solution
DEXTROSE/THEOPHYLLINE 5%-80 MG/100 ML Intravenous solution
DEXTROSE/TICARCILLIN
DEXTROSE/VANCOMYCIN HYDROCHLORIDE 5%-500 MG/100 ML Intravenous solution
Dextrose+lidocaine hydrochloride 75mg/50mg
dextrosimendan
DextroStat
DextroStat 10 MG Oral Tablet
DextroStat 5 MG Oral Tablet
Dextrostat, 10 mg oral tablet
Dextrostat, 5 mg oral tablet
dextrostix
DEXTROSTIX (GLUCOSE) TEST STRIP
DEXTROSTIX (GLUCOSE) TEST STRIP [VA Product]
DEXTROSTIX GLUCOSE TEST STRIP
Dextrostix Reagent Strip
Dextrosulfenidol
Dextrothyroxine
Dextrothyroxine [Chemical/Ingredient]
Dextrothyroxine 1 MG
Dextrothyroxine 1 MG [Choloxin]
Dextrothyroxine 1 MG Oral Tablet
Dextrothyroxine 1 MG Oral Tablet [Choloxin]
Dextrothyroxine 2 MG
Dextrothyroxine 2 MG [Choloxin]
Dextrothyroxine 2 MG Oral Tablet
Dextrothyroxine 2 MG Oral Tablet [Choloxin]
Dextrothyroxine 4 MG
Dextrothyroxine 4 MG [Choloxin]
Dextrothyroxine 4 MG Oral Tablet
Dextrothyroxine 4 MG Oral Tablet [Choloxin]
Dextrothyroxine 6 MG
Dextrothyroxine 6 MG Oral Tablet
Dextrothyroxine causing adverse effects in therapeutic use
DEXTROTHYROXINE NA 1MG TAB
DEXTROTHYROXINE NA 1MG TAB [VA Product]
DEXTROTHYROXINE NA 2MG TAB
DEXTROTHYROXINE NA 2MG TAB [VA Product]
DEXTROTHYROXINE NA 4MG TAB
DEXTROTHYROXINE NA 4MG TAB [VA Product]
DEXTROTHYROXINE NA 6MG TAB
DEXTROTHYROXINE NA 6MG TAB [VA Product]
Dextrothyroxine Oral Tablet
Dextrothyroxine Oral Tablet [Choloxin]
Dextrothyroxine Sodium
DEXTROTHYROXINE SODIUM @ 1MG @ TABLET
DEXTROTHYROXINE SODIUM @ 2MG @ TABLET
DEXTROTHYROXINE SODIUM @ 4MG @ TABLET
DEXTROTHYROXINE SODIUM @ 6MG @ TABLET
dextrothyroxine sodium 1 mg oral tablet
DEXTROTHYROXINE SODIUM 1MG ORAL TABLET
DEXTROTHYROXINE SODIUM 1MG TABLET
dextrothyroxine sodium 2 mg oral tablet
DEXTROTHYROXINE SODIUM 2MG ORAL TABLET
DEXTROTHYROXINE SODIUM 2MG TABLET
dextrothyroxine sodium 4 mg oral tablet
DEXTROTHYROXINE SODIUM 4MG ORAL TABLET
DEXTROTHYROXINE SODIUM 4MG TABLET
DEXTROTHYROXINE SODIUM 6MG ORAL TABLET
DEXTROTHYROXINE SODIUM 6MG TABLET
Dextrothyroxine Sodium Tab 1 MG
Dextrothyroxine Sodium Tab 2 MG
Dextrothyroxine Sodium Tab 4 MG
Dextrothyroxine Sodium Tab 6 MG
DEXTROTHYROXINE [email protected]@[email protected]
DEXTROTHYROXINE [email protected]@[email protected]
DEXTROTHYROXINE [email protected]@[email protected]
DEXTROTHYROXINE [email protected]@[email protected]
dextrous
Dexverapamil
dexverapamil/doxorubicin
dexverapamil/paclitaxel
dexverapamil/vinblastine
dexylosylbenanomicin A
dexylosylbenanomicin B
Dey Brand of Acetylcysteine Sodium Salt
Dey brand of poractant alfa
Dey combination
Dey protein, mouse
Deyeuxia
Deyeuxia aucklandica
Deyeuxia avenoides
Deyeuxia lacustris
Deyeuxia lapponica
Deyeuxia lapponica (Wahlenb.) Kunth
Deyeuxia purpurea
Deyeuxia purpurea (Trin.) Kunth
Deyeuxia quadriseta
deYVY-AVP
Dezacor
dezaguanine
Dezaguanine Mesylate
dezam
dezile
dezinamide
dezocine
dezocine [Chemical/Ingredient]
Dezocine [Mass/volume] in Blood
Dezocine [Mass/volume] in Serum or Plasma
Dezocine [Presence] in Urine
Dezocine [Presence] in Urine by Confirm method
DEZOCINE @ 10MG/ML @ DISPOSABLE SYRINGE (ML)
DEZOCINE @ 10MG/ML @ VIAL (SDV,MDV OR ADDITIVE) (ML)
DEZOCINE @ 15MG/ML @ DISPOSABLE SYRINGE (ML)
DEZOCINE @ 15MG/ML @ VIAL (SDV,MDV OR ADDITIVE) (ML)
DEZOCINE @ 5MG/ML @ DISPOSABLE SYRINGE (ML)
DEZOCINE @ 5MG/ML @ VIAL (SDV,MDV OR ADDITIVE) (ML)
Dezocine | bld-ser-plas
Dezocine | urine
dezocine 10 MG/ML
dezocine 10 MG/ML [Dalgan]
dezocine 10 MG/ML Injectable Solution
dezocine 10 MG/ML Injectable Solution [Dalgan]
DEZOCINE 10 MG/ML Injection (systemic) solution
DEZOCINE 10MG/ML DISPOSABLE SYRINGE (ML)
DEZOCINE 10MG/ML INJ
DEZOCINE 10MG/ML INJ [VA Product]
DEZOCINE 10MG/ML INJECTION DISPOSABLE SYRINGE (ML)
DEZOCINE 10MG/ML INJECTION VIAL (SDV,MDV OR ADDITIVE) (ML)
DEZOCINE 10MG/ML VIAL (SDV,MDV OR ADDITIVE) (ML)
dezocine 15 MG/ML
dezocine 15 MG/ML [Dalgan]
dezocine 15 MG/ML Injectable Solution
dezocine 15 MG/ML Injectable Solution [Dalgan]
DEZOCINE 15 MG/ML Injection (systemic) solution
DEZOCINE 15MG/ML DISPOSABLE SYRINGE (ML)
DEZOCINE 15MG/ML INJ
DEZOCINE 15MG/ML INJ [VA Product]
DEZOCINE 15MG/ML INJECTION DISPOSABLE SYRINGE (ML)
DEZOCINE 15MG/ML INJECTION VIAL (SDV,MDV OR ADDITIVE) (ML)
DEZOCINE 15MG/ML VIAL (SDV,MDV OR ADDITIVE) (ML)
dezocine 5 MG/ML
dezocine 5 MG/ML [Dalgan]
dezocine 5 MG/ML Injectable Solution
dezocine 5 MG/ML Injectable Solution [Dalgan]
DEZOCINE 5 MG/ML Injection (systemic) solution
DEZOCINE 5MG/ML DISPOSABLE SYRINGE (ML)
DEZOCINE 5MG/ML INJ
DEZOCINE 5MG/ML INJ [VA Product]
DEZOCINE 5MG/ML INJECTION DISPOSABLE SYRINGE (ML)
DEZOCINE 5MG/ML INJECTION VIAL (SDV,MDV OR ADDITIVE) (ML)
DEZOCINE 5MG/ML VIAL (SDV,MDV OR ADDITIVE) (ML)
Dezocine Bld-mCnc
dezocine glucuronide
dezocine hydrobromide, (5alpha,11alpha,13*)-isomer
dezocine hydrobromide, (5alpha,11alpha,13S*)-isomer
dezocine hydrobromide, (5R-(5alpha,11alpha,13S*))-isomer
dezocine hydrobromide, (5S-(5alpha,11alpha,13*))-isomer
Dezocine Inj 10 MG/ML
Dezocine Inj 15 MG/ML
Dezocine Inj 5 MG/ML
dezocine Injectable Solution
dezocine Injectable Solution [Dalgan]
Dezocine SerPl-mCnc
Dezocine Ur Ql
Dezocine Ur Ql Cfm
dezocine, (5alpha,11alpha,13S*)-isomer
Dezocine:ACnc:Pt:Urine:Ord
Dezocine:ACnc:Pt:Urine:Ord:Confirm
Dezocine:Arbitrary Concentration:Point in time:Urine:Ordinal
Dezocine:Arbitrary Concentration:Point in time:Urine:Ordinal:Confirm
Dezocine:Mass Concentration:Point in time:Serum/Plasma:Quantitative
Dezocine:Mass Concentration:Point in time:Whole blood:Quantitative
Dezocine:MCnc:Pt:Bld:Qn
Dezocine:MCnc:Pt:Ser/Plas:Qn
[email protected]/[email protected]@DISPOSABLE SYRINGE (ML)
[email protected]/[email protected]@VIAL (SDV,MDV OR ADDITIVE) (ML)
[email protected]/[email protected]@DISPOSABLE SYRINGE (ML)
[email protected]/[email protected]@VIAL (SDV,MDV OR ADDITIVE) (ML)
[email protected]/[email protected]@DISPOSABLE SYRINGE (ML)
[email protected]/[email protected]@VIAL (SDV,MDV OR ADDITIVE) (ML)
Dezocitidine
Dezone
DF
DF 10967
DF 11062
DF 11113
DF 118
DF 203
DF 2156A
DF 2156Y
DF 2162
DF 31
DF 521
DF 526
DF 545
DF 594
Df protease
DF protocol
DF-10967
DF-11062
DF-11113
DF-1770y
DF-203
DF-2156A
DF-2156Y
DF-2162
DF-521
DF-526
DF-545
DF-594
DF-epsilon-ATP
DF-folate(gamma)
DF-HSA
Df-protease
DF(2) neuropeptide
DF/HCC
DF118
DF118 2 MG/ML Oral Solution
DF118 30 MG Oral Tablet
DF118 50 MG/ML Injectable Solution
DF118 Forte
DF118 Forte 40 MG Oral Tablet
DF2 neuropeptide
DF2156A
DF2156Y
DF2162
DF3 Antigen
DF3 breast-carcinoma-associated antigen
Df31 protein, Drosophila
DF5L
DFA
DFA III
dFADD protein, Drosophila
Dfak56 protein, Drosophila
DFAQ-7
DFAT
DFB-2-arylbenzimidazole
DFBP compound
DFC-GCVIA
dFC5-cytosine
DFCI 85 01
DFCI 85-01 protocol
DFCI 8501
DFCI 91-01 protocol
DFCI 95-01 protocol
DFCP-HPAA
DFCP1
DFCP1 protein, human
DFD
Dfd protein, Drosophila
Dfd-like protein, human
Dfd, DROSOPHILA, HOMOLOG OF
dFdC
dFdC/5-FU
DFdC/5-FU/IFN-A/IL-2
dFdC/5-FU/L-OHP
dFdC/5-FU/TAX
dFdC/DHA-TAX
dFdC/DOX
dFdC/DOX//VBL
dFdC/DOX/IFF
dFdC/DX-8951f
dFdC/EPI
dFdC/FLAVO
dFdC/G-CSF/TXT
dFdC/G3139
dFdC/GCSF-SD01/TXT
dFdC/GTI2040
dFdC/ISIS-2503
dFdC/L-OHP
dFdC/L-OHP/MOAB VEGF
dFdC/LipoDox
dFdC/LipoDox/VNB
dFdC/LY-293111
dFdC/LY231514
dFdC/MOAB 2C4
dFdC/MOAB C225
dFdC/MOAB C225/MOAB VEGF
dFdC/MOAB HER2
dFdC/MOAB VEGF
dFdC/MOAB VEGF/OSI774
dFdC/OSI774
dFdC/PS-341
dFdC/PT-100
dFdC/R115777
dFdC/SC-58635
dFdC/SCH 66336
dFdC/SFN
dFdC/SGN-15
dFdC/SU-5416
dFdC/SUR
dFdC/TAX
dFdC/TOPO
dFdC/TXT
dFdC/TZT1027
dFdC/UCN 01
dFdC/VIRU
dFdC/Viscum
dFdC/VNB
dFdC/VP-16
dFdCyd
DFDDS
DFDM-calcifediol
DFDM-calcitriol
DFDNPS
DFF cpd
DFF protein
DFF-40
DFF-45
DFF-45 protein
DFF1
DFF2
DFF35 protein
DFF40
DFF40 protein, human
DFF40 protein, mouse
DFF40 protein, rat
DFF45
DFF45 protein
DFF45 protein, human
Dff45 protein, mouse
DFFA
DFFA gene
DFFA protein, human
Dffa protein, mouse
DFFA-like B protein, mouse
DFFB
DFFB gene
DFFB protein, human
Dffb protein, mouse
Dffb protein, rat
DFFBD-morph-methanone
DFFRX
DFFRX protein, mouse
DFFRY
DFFT drug
DFFTP-daunomycinone
DFG1 protein, S cerevisiae
DFG16 protein, S cerevisiae
Dfh protein, Drosophila
DFH-4T cpd
DFH-theophylline
DFHGC
DFHHA
DFHKSEIAHRFNDLGEKMFKMLNLDMRNMYLQQKTS
DFHPP cpd
DFHTDTD-PGlu
DFICZ
DFKi
DFL1 protein, Arabidopsis
DFL2 protein, Arabidopsis
DFLDEHPROSTA
DFLEDA
DFLHC
DFLys cpd
DFM
DFM iodide, (2R(-)-(2alpha,4alpha,5alpha))-
DFM iodide, (2R(-)-(2alpha,4beta,5beta))-
DFM iodide, (2S(-)-(2alpha,4alpha,5alpha))-
DFM iodide, (2S(-)-(2alpha,4beta,5alpha))-
DFM-DOPA
DFM-PFE
DFM-TFE
Dfm1 protein, S cerevisiae
DFMDP
dFMGEN cpd
DFMGPC
DFMMPIP cpd
DFMO
DFMO-PCV protocol
DFMO/DOX/IFN-A
DFMO/IFN-A
DFMO/MGBG
DFMO/PXM
DFMO/SC-58635
DFMO/SULIN
DFMOIAA
DFMPDF-pyrimidinone
DFMPQ
dFMR1 protein, Drosophila
DFMSA
DFMT-DHP
DFMT-P
DFN1 protein, human
DFN1, FORMERLY
DFN2
DFN2 gene
DFN3
DFN3 protein, human
DFN4
DFN4 gene
DFN5 gene
DFN6
DFN6 gene
DFN7
DFN8 gene
DFNA1
DFNA1 protein, human
DFNA10
DFNA10 protein, human
DFNA11
DFNA11 protein, human
DFNA12
DFNA12 protein, human
DFNA13
DFNA13 protein, human
DFNA14
DFNA14 protein, human
DFNA15
DFNA15 protein, human
DFNA16
DFNA16 gene
DFNA17
DFNA17 protein, human
DFNA18
DFNA18 gene
DFNA19 gene
DFNA2 protein, human (potassium channel)
DFNA2 protein, mouse (potassium channel)
DFNA2 protein, rat (potassium channel)
DFNA20
DFNA21
DFNA21 gene
DFNA22
DFNA22 protein, human
DFNA23
DFNA24
DFNA24 gene
DFNA25
DFNA26
DFNA27
DFNA27 gene
DFNA28
DFNA28 protein, human
DFNA29 gene
DFNA2A
DFNA2B
DFNA3 protein, human
DFNA30
DFNA30 gene
DFNA31
DFNA31 gene
DFNA32 gene
DFNA33 gene
DFNA34 gene
DFNA35 gene
DFNA36
DFNA37 gene
DFNA38
DFNA38 protein, human
DFNA39/DENTINOGENESIS IMPERFECTA 1 SYNDROME
DFNA39/DGI1 SYNDROME
DFNA3A
DFNA3B
DFNA4
DFNA4 protein, human
DFNA40
DFNA40 gene
DFNA41
DFNA41 gene
DFNA42 gene
DFNA43
DFNA43 gene
DFNA44
DFNA45 gene
DFNA46 gene
DFNA47
DFNA47 gene
DFNA48
DFNA49
DFNA49 gene
DFNA5
DFNA5 gene
DFNA5 protein, human
DFNA5 protein, mouse
dfna5 protein, zebrafish
DFNA5, 3-BP DEL, 372CTT
DFNA5, INV/DEL, EX8DEL
DFNA5, IVS7, C-G, -6
DFNA5, IVS8DS, A-G, +4
DFNA50 gene
DFNA51 gene
DFNA52
DFNA52 gene
DFNA53
DFNA53 gene
DFNA53 protein, human
DFNA54 gene
DFNA57 gene
DFNA58 gene
DFNA59
DFNA59 gene
Dfna5h protein, mouse
130 131 132 133 134