dict.md logo
Results for H in English, page 190
hsa-mir-671
hsa-mir-675
hsa-mir-7-1
hsa-mir-7-2
hsa-mir-7-3
hsa-mir-708
hsa-mir-720
hsa-mir-744
hsa-mir-758
hsa-mir-760
hsa-mir-765
hsa-mir-766
hsa-mir-767
hsa-mir-768
hsa-mir-769
hsa-mir-770
hsa-mir-802
hsa-mir-873
hsa-mir-874
hsa-mir-875
hsa-mir-876
hsa-mir-877
hsa-mir-885
hsa-mir-886
hsa-mir-887
hsa-mir-888
hsa-mir-889
hsa-mir-890
hsa-mir-891a
hsa-mir-891b
hsa-mir-892a
hsa-mir-892b
hsa-mir-9
hsa-mir-9-1
hsa-mir-9-2
hsa-mir-9-3
hsa-mir-92-1
hsa-mir-92-2
hsa-mir-920
hsa-mir-921
hsa-mir-922
hsa-mir-924
hsa-mir-92a microRNA
hsa-mir-92a-1
hsa-mir-92a-2
hsa-mir-92b
hsa-mir-93
hsa-mir-933
hsa-mir-934
hsa-mir-935
hsa-mir-936
hsa-mir-937
hsa-mir-938
hsa-mir-939
hsa-mir-940
hsa-mir-941-1
hsa-mir-941-2
hsa-mir-941-3
hsa-mir-941-4
hsa-mir-942
hsa-mir-943
hsa-mir-944
hsa-mir-95
hsa-mir-96
hsa-mir-96, human
hsa-mir-98
hsa-mir-99a
hsa-mir-99b
HSA-PAA-PEG copolymer
HSA-PTAAC-PEG copolymer
HSA011372
HSA011916
HSA1
HSA238520
HSA238982
HSA242976
HSA243396
HSA250303
HSA269537
HSA271784
HSA272196
HSA272268
HSA275986
HSA277276
HSA277841
Hsa32 protein, Arabidopsis
HSA404617
HSA6591
HSA9761
HSA9947
HSAB
HSAc-Phe-Leu
hSac2
hSac3
HsaD protein, Mycobacterium tuberculosis
hsADAR1
Hsadhc3
HsaI Endonuclease
HSAJ2425 protein, human
HSAL-chlorambucil
HSAL1
Hsal1 protein, human
HSAL2
Hsal2 protein, human
HSAL4
hsaMrs2 protein, human
HSAN
HSAN (Hereditary Sensory and Autonomic Neuropathy) Type III
HSAN (Hereditary Sensory Autonomic Neuropathy)
HSAN 1
HSAN 3
HSAN 4
HSAN I
HSAN II
HSAN III
HSAN IV
HSAN Type I
HSAN Type II
HSAN Type III
HSAN Type IIIs
HSAN Type IIs
HSAN Type Is
HSAN Type IV
HSAN Type V
HSAN V
HSAN1
HSAN1B
HSAN2
HSAN3
HSAN4
HSAN5
HSANs (Hereditary Sensory Autonomic Neuropathy)
HSAP 48-kDa, human
HsApg4A protein, human
hSARA
HSAS
HSAS1
hsat-1 transporter, human
HSATA
HsAtg4B protein, human
HSB
hSB1 protein, human
hsBG
HSBLMHC1
hSBP
HSBP1
HSBP1 gene
HSBP1 protein, human
HSBP1P1 gene
HSC
HSC 070 HEAT SHOCK PROTEINS
HSC-71 protein, human
HSC-CF
HSc025
Hsc1 protein, S pombe
hsc1+ protein, S pombe
HsC2-PI3K, human
HSC20
Hsc20 protein, E coli
HSC20 protein, human
HSC20, E. COLI, HOMOLOG OF
HSC3
HSC40
HSC40 protein, human
hsc40 protein, mouse
HSC54 protein, human
Hsc56 protein, E coli
Hsc62 protein, E coli
Hsc66 protein, E coli
HSC70
HSC70 Heat Shock Proteins
HSC70 Heat-Shock Proteins
HSC70 Heat-Shock Proteins [Chemical/Ingredient]
HSC70 Interacting Protein
Hsc70 interacting protein (molecular function)
Hsc70 Protein
Hsc70 protein regulator activity
HSC70 protein, human
Hsc70 protein, mouse
Hsc70 protein, rat
hsc70 protein, zebrafish
hsc70-3 protein, Lycopersicon esculentum
Hsc70-4 protein, Drosophila
HSC70-INTERACTING PROTEIN
hsc70.II protein, Xenopus
HSC71
HSC71 protein, human
Hsc71 protein, mouse
HSC73 Protein
Hsc73 protein, mouse
hscA protein, E coli
HSCARG
HSCARG protein, human
HSCAS
HSCAS-1
HSCAS-3
HSCB
HSCB gene
HscB iron-sulfur cluster co-chaperone homolog (E. coli)
HscB iron-sulfur cluster co-chaperone homolog (E. coli), human
HscB protein, Arabidopsis
HscB protein, E coli
HSCB protein, human
HSCBCIP1
hscC protein, E coli
HSCCT
HSCD5
hSCD5 protein, human
HsCDC18
HsCDC6
HsCDC7
HsCDC7 protein, human
HsCEN3 protein, human
HSCH2CH(CH2CH(CH3)2)CO-Phe-Ala-NH2
HSCH2CH(CH2CH(CH3)2)CO-phenylalanyl-alaninamide
HSCLT
HSCO
HSCO protein, human
HSCR
HSCR1
HSCR1 protein, human
HSCR1 transmembrane receptor protein tyrosine kinase activity
HSCR2
HSCR3
HSCR4
HSCR5
HSCR6
HSCR7
HSCR8
HSCR9
hScrib protein, human
hScrib-APC complex
hScrib-APC complex location
hScrib-APC-beta-catenin complex
hScrib-APC-beta-catenin complex location
HSCRISP1D
HSCRISP1G
HSCT
HSCTCyclodextrin
hscy protein, mouse
HSD solution
HSD-1
HSD-1 protein, human
HSD-3.1 protein, human
HSD-3.8
HSD-3.8 protein, human
HSD-40
HSD-PLA2
HSD1
HSD1 protein, Arabidopsis
HSD1 protein, S cerevisiae
HSD1 protein, Saccharomyces cerevisiae
HSD11, KIDNEY AND PLACENTAL TYPE
HSD11, TYPE II
HSD11B1
HSD11B1 DEFICIENCY
HSD11B1 gene
HSD11B1 protein, human
HSD11B1, 1-BP INS, 83557A AND 83597T-G
HSD11B1L gene
HSD11B2
HSD11B2 gene
HSD11B2 protein, human
HSD11B2, 6-BP DEL, LEU114/GLU115
HSD11B2, ARG208CYS
HSD11B2, ARG208HIS
HSD11B2, ARG213CYS
HSD11B2, ARG279CYS
HSD11B2, ARG337CYS
HSD11B2, ARG337HIS, TYR338DEL
HSD11B2, ASP223ASN, C7279T
HSD11B2, PRO227LEU
HSD11B2, TYR299 DEL
HSD11K
HSD11K protein, human
HSD11L
HSD14
HSD15
HSD17
HSD17B1
HSD17B1 gene
HSD17B1 protein, human
HSD17B10
HSD17B10 gene
HSD17B10 protein, human
HSD17B10, ARG130CYS
HSD17B10, ARG192ARG
HSD17B10, ASN247SER
HSD17B10, LEU122VAL
HSD17B11 gene
HSD17B11 protein, human
HSD17B12
HSD17B12 gene
HSD17B13
HSD17B13 gene
HSD17B13 protein, mouse
HSD17B14 gene
HSD17B14 protein, human
HSD17B2
HSD17B2 gene
HSD17B2 protein, human
Hsd17b2 protein, mouse
HSD17B2 wt Allele
HSD17B3
HSD17B3 gene
HSD17B3, ALA203VAL
HSD17B3, ALA56THR
HSD17B3, ARG80GLN
HSD17B3, ARG80TRP
HSD17B3, ASN130SER
HSD17B3, CYS268TYR
HSD17B3, IVS3AS, G-C, -1
HSD17B3, IVS8AS, G-A, -1
HSD17B3, MET235VAL
HSD17B3, SER232LEU
HSD17B4
HSD17B4 gene
HSD17B4 protein, human
Hsd17b4 protein, mouse
Hsd17b4 protein, rat
HSD17B4, 138-BP DEL
HSD17B4, 2-BP DEL, 422AG
HSD17B4, 237-BP DEL
HSD17B4, 52-BP DEL
HSD17B4, ARG106PRO
HSD17B4, ASN457TYR
HSD17B4, GLY16SER
HSD17B5
HSD17B5 protein, human
HSD17B6
HSD17B6 gene
HSD17B6 protein, human
HSD17B7
HSD17B7 gene
HSD17B7 protein, human
HSD17B7 protein, mouse
Hsd17b7 protein, rat
HSD17B7 wt Allele
HSD17B7P1 gene
HSD17B7P2 gene
HSD17B8
HSD17B8 gene
HSD17B8 protein, human
HSD17B9
HSD17BP1 gene
HSD2
HSD22
HSD3
HSD3 protein, human
HSD3B1
HSD3B1 gene
HSD3B2
HSD3B2 gene
HSD3B2, 1-BP DEL, 867G
HSD3B2, 1-BP INS
HSD3B2, ALA10GLU
HSD3B2, ARG249TER
HSD3B2, GLU142LYS
HSD3B2, PRO222THR
HSD3B2, PRO341LEU
HSD3B2, TER373CYS
HSD3B2, THR259MET
HSD3B2, TRP171TER
HSD3B2, VAL248ASN
HSD3B7
HSD3B7 gene
HSD3B7, 1-BP INS, 310C
HSD3B7, 2-BP DEL, 63AG
HSD3B7, 2-BP DEL, NT1057
HSD3B7, GLU147LYS
HSD3B7, IVS2, 340G-T, +1
HSD3BP1 gene
HSD3BP2 gene
HSD3BP3 gene
HSD3BP4 gene
HSD3BP5 gene
HSD4
HSD45 protein, rat
HSD5
HSD6
HSD7
hSDA protein, human
HSDAA cpd
HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY
HSDB
HSDB 7209
HSDB 7547
HSDB 7549
HSDB-3453
HSDJ
HSDJ protein, human
HSDJ0609N19
HSDJ0798C17
HSDL1 gene
HSDL1 protein, human
HSDL2 gene
HSDL2 protein, human
Hsdl2 protein, mouse
hsdM protein, Bacillus subtilis
HsdM protein, Bacteria
HsDmc1 protein, human
HsdR protein, E coli
hSDR-O protein, human
hsdrM protein, Bacillus subtilis
HSDS protein, Bacteria
hsdS protein, E coli
HSE
Hse(32)-amide-eel calcitonin
HSE1
Hse1 protein, S cerevisiae
hSec10 protein, human
hSEF protein, human
HsEg5 Protein
HSEGTDTSD
Hsema-I
HSEPI
HSET
HSET protein, human
hSET2
hSet2 protein, human
HSF
HSF 1
HSF Gene
HSF III
HSF III (hepatocyte stimulating factor III)
Hsf protein, bacteria
Hsf protein, Drosophila
HSF-1
hsf-1 protein, C elegans
HSF-27
HSF-27 protein, human
HSF-4a protein, human
HSF-4b protein, human
HSF-6
HSF1
HSF1 gene
HSF1 protein, Arabidopsis
HSF1 protein, human
Hsf1 protein, mouse
Hsf1 protein, rat
HSF1 protein, S cerevisiae
hsf1 protein, zebrafish
HSF1 wt Allele
HSF2
HSF2 gene
HSF2 protein, Arabidopsis
HSF2 protein, human
Hsf2 protein, mouse
HSF2 protein, Xenopus
HSF2 protein, zebrafish
HSF24 protein, Lycopersicon peruvianum
HSF2A protein, human
HSF2B protein, human
HSF2BP
HSF2BP gene
HSF2L
HSF3 protein, Arabidopsis
HSF3 protein, Gallus gallus
HSF4
HSF4 gene
HSF4 protein, Arabidopsis
HSF4 protein, human
Hsf4 protein, mouse
HSF4 protein, rat
HSF4, ALA20ASP
HSF4, ARG120CYS
HSF4, ILE87VAL
HSF4, LEU115PRO
HSF5 gene
HsfA protein, Bradyrhizobium japonicum
HSFA2 protein, Arabidopsis
HSFA3 protein, Arabidopsis
HsfA9 protein, Arabidopsis
HSFGFR3EX
hSfi1 protein, human
hSFMBT protein, human
HSFP enzyme
HSFX1 gene
HSFX1 protein, human
HSFX2 gene
HSFY
HSFY1 gene
HSFY2 gene
HSG (hysterosalpingogram)
HSG 3-O-sulfotransferase
HSGA
hSgo2 protein, human
HSGP25L2G
hSGT1
hSGT2
hSgt2p
HSGTI
HSH
HSH A50
HSH B60
HSH boron
HSH protein, Haloarcula marismortui
HSH-A50
HSH-B60
HSH155 protein, S cerevisiae
188 189 190 191 192