dict.md logo
Results for W in English, page 25
western waterhemp pollen extract 10000 UNT/ML
western waterhemp pollen extract 10000 UNT/ML Injectable Solution
western waterhemp pollen extract 20000 UNT/ML
western waterhemp pollen extract 20000 UNT/ML Injectable Solution
western waterhemp pollen extract 25 MG/ML
western waterhemp pollen extract 25 MG/ML Injectable Solution
western waterhemp pollen extract 40000 UNT/ML
western waterhemp pollen extract 40000 UNT/ML Injectable Solution
western waterhemp pollen extract 50 MG/ML
western waterhemp pollen extract 50 MG/ML Injectable Solution
western waterhemp pollen extract Injectable Solution
Western Wattled Cuckoo Shrike
Western wheatgrass (pascopyrum smithii) | bld-ser-plas
Western wheatgrass IgE Ab [Units/volume] in Serum
Western wheatgrass IgE Ab RAST class in Serum
western wheatgrass pollen extract
western wheatgrass pollen extract 50 MG/ML
western wheatgrass pollen extract 50 MG/ML Injectable Solution
western wheatgrass pollen extract Injectable Solution
Western Whipbird
Western White pine (Pinus monticola) | bld-ser-plas
Western White Pine IgE Ab [Units/volume] in Serum
western white pine pollen extract
western white pine pollen extract 100 MG/ML
western white pine pollen extract 100 MG/ML Injectable Solution
western white pine pollen extract 50 MG/ML
western white pine pollen extract 50 MG/ML Injectable Solution
western white pine pollen extract Injectable Solution
Western white trillium
Western Wild Mouse
western wild rose
Western Wood Pewee
Western World
Western X mycoplasma-like organism
Western X phytoplasma
Western X-disease mycoplasma-like organism
Western X-disease phytoplasma
western yellow-bellied eleuth
WesternApachean
westerner
westerners
westernization
westernize
westernized
westernizes
westernizing
WesternMiwok
WesternMuskogean
WesternNumic
Westfall Young
Westfall Young Adjustment
Westfall Young Correction
Westfall Young Method
Westhroid
Westhroid 120 MG Oral Tablet
Westhroid 130 MG Oral Tablet
Westhroid 180 MG Oral Tablet
Westhroid 240 MG Oral Tablet
Westhroid 30 MG Oral Tablet
Westhroid 300 MG Oral Tablet
Westhroid 60 MG Oral Tablet
Westhroid 65 MG Oral Tablet
Westhroid, 120 mg oral tablet
Westhroid, 130 mg oral tablet
Westhroid, 180 mg oral tablet
Westhroid, 240 mg oral tablet
Westhroid, 30 mg oral tablet
Westhroid, 300 mg oral tablet
Westhroid, 32.5 mg oral tablet
Westhroid, 60 mg oral tablet
Westhroid, 65 mg oral tablet
Westie
westiellamide
Westiellopsis
Westiellopsis prolifica
Westiellopsis sp. 1590-1
Westiellopsis sp. 1590-2
Westiellopsis sp. 89-785/4
Westiellopsis sp. 985-1
Westiellopsis sp. Ar73
Westland Petrel
Westphal pseudosclerosis
Westphal Strumpell disease
Westphal Strumpell Syndrome
WESTPHAL-STRUEMPELL PSEUDOSCLEROSIS
Westphal-Strumpell Syndrome
Westphal-Strumpell Syndromes
Westphalia
Westracystis
Westracystis lissus
Westrapyrgus
Westrapyrgus westralis
Westrarchaea
Westrarchaea spinosa
Westrarchaea spinosa Rix, 2006
Westrim
Westrim 37.5 MG Oral Tablet
Westrim LA
Westrim LA 75 MG Extended Release Capsule
Westrim LA, 75 mg oral capsule, extended release
Westrim, 37.5 mg oral tablet
Westringia
Westringia dampieri
Westringia dampieri R.Br.
Westringia rosmariniformis
Westringia rosmariniformis Sm.
Westringia Sm.
Westringieae
westward
westwards
Westwood brand of sulconazole nitrate
Westwood rim
Westwood Squibb Brand of Aminobenzoic Acid
Westwood Squibb brand of halobetasol propionate
Westwood Squibb brand of haloprogin
Westwood Squibb brand of zinc pyrithione
Westwoodia
Westwoodia ruficeps
westwork
wet
wet alarm valve station
wet all over
wet ash handling
WET ASH METHOD, PROTEIN-BOUND IODINE
wet blanket
wet blankets
wet brain
wet cleaning
wet concrete
Wet crab yaws
wet crushing
wet dock
wet dream
wet dressing
WET DRESSING @ 4"X4" @ BANDAGE
WET DRESSING @ 4"X8" @ BANDAGE
WET DRESSING @ 8"X18" @ BANDAGE
WET DRESSING 4"X4" BANDAGE
WET DRESSING 4"X8" BANDAGE
WET DRESSING 4"X8" TOPICAL BANDAGE
WET DRESSING 8"X18" BANDAGE
WET DRESSING 8"X18" TOPICAL BANDAGE
wet feed
wet fog
Wet gangrene
wet grip
wet locker
wet lockers
Wet Lung
WET LUNG SYNDROME
Wet Lungs
Wet Macular Degeneration
Wet Macular Degenerations
wet meadow
Wet mount panel
Wet mount panel | Vaginal
Wet mount panel in Vaginal fluid
Wet mount panel:-:Point in time:Vagina:-
Wet mount panel:-:Pt:Vag:-
Wet mount Pnl Vag
WET MOUNTS, INCLUDING PREPARATIONS OF VAGINAL, CERVICAL OR SKIN SPECIMENS
Wet mounts/ w preparations
wet nurse
wet oneself laughing
Wet paint!
wet patch
Wet Prep Cervix
Wet Prep Duod fl
Wet Prep Fld
Wet Prep Genital
Wet Prep Stl
Wet Prep Tiss
Wet Prep Urth
Wet Prep Vag
Wet Prep XXX
Wet preparation
wet road holding
wet sand
wet scraper ash extractor
wet screening
wet scrubber
wet season
wet senile macular degeneration
wet shelter
wet signature
wet sprayer
wet standpipe
wet suit
wet suits
wet the bed
wet to the skin
wet trades
WET WAX
wet weather protection suit
wet weather protection suits
wet-bottom boiler
wet-bulb thermometer
wet-bulb thermometers
Wet-Comod
wet-dry filter
wet-dry filters
Wet-N-Soak Plus
wet-nurse
Wet-nurses
Wet, gurgling, hoarse voice
wetA protein, Aspergillus nidulans
Wetabilities
Wetability
Wetapolystoma
Wetapolystoma almae
Wetar Ground Dove
wetback
wetbike
wether
Wetherbeella
Wetherbeella australica
Wetherbeella foliosa
wethers
Wetland
Wetlands
wetly
Wetmorella
Wetmorella nigropinnata
Wetmorena
Wetmorena haetiana
Wetness
Wetness | patient
Wetness | patient | Bld-Ser-Plas
Wetness RFC
Wetness:Find:Pt:^Patient:Ord:RFC assessment
Wetness:Finding:Point in time:^Patient:Ordinal:RFC assessment
Wetria
Wetria australiensis
Wetria australiensis P.I.Forst.
Wetria Baill.
Wetria insignis
Wetria insignis (Steud.) Airy Shaw
wets
wetstone cutter
wetstone cutters
wetsuit
wetsuits
Wettabilities
Wettability
wettable
wetted
wetted water
wetter
wettest
wettie
wetties
Wetting
wetting (of a sample)
wetting agent
Wetting Agents
wetting film
WETTING SOLN GAS,HARD & SOFT @ @ DROPS
WETTING SOLN GAS,HARD & SOFT DROPS
WETTING SOLN GAS,HARD & SOFT OPHTHALMIC DROPS
Wetting Solutions, Contact Lens
Wetting, Daytime
Wettinia
Wettinia hirsuta
Wettsteinia
Wettsteinia schusteriana
Wettsteinia schusteriana Grolle
Wettsteinina
Wettsteinina dryadis
Wettsteinina lacustris
Wettsteinina macrotheca
Wettsteinina pachyasca
WEVLLNVALIRLELLSCRSSKDQDQKESCGMHSW
wewakazole
wewakpeptin A
wewakpeptin B
WEX protein, Arabidopsis
WEYERS ACRODENTAL DYSOSTOSIS, SER307PRO
WEYERS ACROFACIAL DYSOSTOSIS
WEYERS ACROFACIAL DYSOSTOSIS, 1-BP DEL, 3793C
WEYERS ULNAR RAY/OLIGODACTYLY SYNDROME
Weymouthia
Weymouthia billardieri
Weymouthia cochlearifolia
Weymouthia mollis
Weyn's Weaver
Weyprechtia
Weyprechtia pinguis
Weyrauchia
Weyrauchia peruviana
Weyrauchia peruviana (Lallemand, 1956)
WF
WF 10 cpd
WF 10129
WF 11
WF 11 compound
WF 11605
WF 11899A
WF 11899B
WF 11899C
WF 13
WF 1360B
WF 1360C
WF 1360E
WF 1360F
WF 14861
WF 14865A
WF 14865B
WF 16616
WF 16775 A1
WF 16775 A2
WF 22210
WF 23 compound
WF 2421
WF 31 compound
WF 3161
WF 3405
WF 3681
WF 5239
wf protein, Drosophila
WF Rat
WF Rat, Inbred
WF Rats
WF Rats, Inbred
WF-1
WF-10129
WF-11
WF-11 compound
WF-11605
WF-11899A
WF-11899B
WF-11899C
WF-1360
WF-14861
WF-14865A
WF-14865B
WF-16616
WF-16775 A1
WF-16775 A2
WF-22210
WF-23 cpd
WF-2421
WF-31 tropane
WF-3161
WF-3405
WF-3681
Wf-516
WF-5239
Wf-536
WF, Rat Strain
WF10 cpd
WF11 compound
WF11605
WF11899A
WF11899B
WF11899C
WF1360
WF14861
WF16616
WF22210
WF23 cpd
WFDC1
WFDC1 gene
WFDC1 Protein
WFDC1 protein, human
Wfdc1 protein, mouse
Wfdc1 protein, rat
WFDC1 wt Allele
WFDC10A gene
WFDC10B gene
WFDC11 gene
WFDC12
WFDC12 gene
WFDC12 protein, human
WFDC13 gene
WFDC14
WFDC14 protein, human
WFDC2
WFDC2 gene
WFDC2 protein, human
WFDC2 wt Allele
WFDC3 gene
WFDC4
WFDC4 protein, human
WFDC5
WFDC5 gene
WFDC5 protein, human
WFDC6 gene
WFDC7
WFDC8 gene
WFDC9 gene
WFIKKN
WFIKKN protein, human
WFIKKN RELATED-PROTEIN
WFIKKN-related protein, human
WFIKKN1
WFIKKN1 gene
WFIKKN2
WFIKKN2 gene
WFIKKNRP
WFIKKNRP protein, human
WFPT
WFS
WFS1
WFS1 gene
WFS1 gene Mut Anal Bld/T
WFS1 gene mutation analysis
WFS1 gene mutation analysis:Presence or Identity:Point in time:Whole blood/Tissue, unspecified:Narrative:MOLECULAR GENETICS
WFS1 gene mutation analysis:Presence or Identity:Point in time:Whole blood/Tissue, unspecified:Nominal:MOLECULAR GENETICS
WFS1 GENE MUTATION ANALYSIS:PRID:PT:BLD/TISS:NAR:MOLGEN
WFS1 GENE MUTATION ANALYSIS:PRID:PT:BLD/TISS:NOM:MOLGEN
WFS1 Gene Mutation Detection Reagents
WFS1 gene mutations found [Identifier] in Blood or Tissue by Molecular genetics method Narrative
WFS1 gene mutations found [Identifier] in Blood or Tissue by Molecular genetics method Nominal
WFS1 protein, human
Wfs1 protein, mouse
WFS1 protein, rat
WFS1, 15-BP DEL, NT1685
WFS1, 16-BP DEL, NT1362
WFS1, 16-BP DUP, NT409
WFS1, 2-BP DEL, 2812TC
WFS1, 4-BP DEL, NT2648
WFS1, 460, G-A, +1
WFS1, 7-BP INS, NT1610
WFS1, 9-BP DEL, NT1380
WFS1, ALA716THR
WFS1, ARG859GLN
WFS1, GLN226TER
WFS1, GLN819TER
WFS1, GLU864LYS
WFS1, GLY695VAL
WFS1, GLY831ASP
WFS1, LEU829PRO
WFS1, LYS634THR
WFS1, PRO504LEU
WFS1, PRO724LEU
WFS1, rs10010131
WFS1, rs6446482
WFS1, THR699MET
WFS1, TRP648TER
WFS2
WG
WG : wicked (winked) grin
WG 253
WG 284
wg protein, Drosophila
WG-253
WG-284
WG-55 protein, Triticum aestivum
WGA HRP
WGA-apoHRP gold
WGA-BSA
WGA-gold
WGA-HRP
WGA-RAC
WGA-sepharose
WGA-sepharose 6MB
WGAR9166
wge protein, Drosophila
WGEF
WGEF protein, mouse
WGG motif containing 1
WGG1
WGHE tetrapeptide
WGHT - Retired Code
WGN1
WGTI I protein, Triticum
WGTI II protein, Triticum
Wh
WH 9062
wh protein, Drosophila
wh-
WH-9062
wh-in-situ
wh-phrase
wh-question
wh-word
WH, Rat Strain
Wh11 protein, Candida albicans
WH2 DOMAIN-CONTAINING PROTEIN 1
WH30 +herbal preparation
WH9062
wha
whack
whacked
whacker
whackest
whacketh
whacking
whacko
whackos
whacks
whacky
whale
Whale and Dolphin Conservation Society
whale bone
whale bones
whale bull
whale calf
whale calves
whale catfishes
23 24 25 26 27